The domain within your query sequence starts at position 17 and ends at position 114; the E-value for the TIP_N domain shown below is 1.4e-30.

DDDDERENFEITDWDLQNEFNPNRQRHWQTKEEATYGVWAERDSDEERPSFGGKRARDYS
APVNFISAGLKKGAAEEADSEDSDAEEKPVKQEDFPKD

TIP_N

TIP_N
PFAM accession number:PF12457
Interpro abstract (IPR022159):

This domain is found in septin and tuftelin-interacting protein (STIP) and tuftelin-interacting protein 11 (TFIP11). STIP is essential for embryogenesis in Caenorhabditis elegans [(PUBMED:17289020)]. Tuftelin-interacting protein 11 is a component of the spliceosome involved in spliceosome disassembly [(PUBMED:19857462)]. TFIP11 was first identified in a yeast two-hybrid screening as a protein interacting with tuftelin, one of the presumed enamel matrix proteins [(PUBMED:11063033)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TIP_N