The domain within your query sequence starts at position 26 and ends at position 147; the E-value for the TLD domain shown below is 2.8e-7.

LLYKASVQKFSHQNLLCTCENQGPTMIVVYSEKCVIGMYLKEGFQGKDVSITIFALQETG
FSLCAKGPDSPYLLFHKRKTNDFSILLDEKAVIVSSAICKMLQLTARNNVIPIQECEAFR
CE

TLD

TLD
PFAM accession number:PF07534
Interpro abstract (IPR006571):

TLDc is a domain of unknown function, restricted to eukaryotes, and commonly found in TBC (IPR000195) and LysM domain containing proteins [(PUBMED:11779830)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TLD