The domain within your query sequence starts at position 1 and ends at position 53; the E-value for the TLE_N domain shown below is 7.3e-35.

MQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVE

TLE_N

TLE_N
PFAM accession number:PF03920
Interpro abstract (IPR005617):

The N-terminal domain of the Grouch/TLE co-repressor proteins are involved in oligomerisation.

GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TLE_N