The domain within your query sequence starts at position 6 and ends at position 63; the E-value for the TM140 domain shown below is 4.9e-26.

LWRNNHLPFVGIMILLAAALCLMFYALLWKAGNLADLPSLRIGFYNFCLWKEDMGSL

TM140

• PFAM accession number: PF14985
• Interpro abstract (IPR028038):

  This family of uncharacterised membrane proteins are called transmembrane protein 140. Their function is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TM140