The domain within your query sequence starts at position 113 and ends at position 162; the E-value for the TM2 domain shown below is 4.6e-20.

NGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFI

TM2

TM2
PFAM accession number:PF05154
Interpro abstract (IPR007829):

This domain is composed of a pair of transmembrane alpha helices connected by a short linker. The function of this domain is unknown, however it occurs in a wide range or protein contexts.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TM2