The domain within your query sequence starts at position 3 and ends at position 64; the E-value for the TMA7 domain shown below is 4.9e-33.
GREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSG KK
TMA7 |
 |
|---|
| PFAM accession number: | PF09072 |
|---|---|
| Interpro abstract (IPR015157): | TMA7 plays a role in protein translation. Deletions of the TMA7 gene results in altered protein synthesis rates [ (PUBMED:16702403) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMA7