The domain within your query sequence starts at position 556 and ends at position 671; the E-value for the TMC domain shown below is 8.6e-41.

CWETAVGIEFMRLTVSDMLVTYLTILVGDFLRACFVRFMNHCWCWDLEAGFPSYAEFDIS
GNVLGLIFNQGMIWMGSFYAPGLVGINVLRLLTSMYFQCWAVMSSNVPHERVFKAS

TMC

TMC
PFAM accession number:PF07810
Interpro abstract (IPR012496):

These sequences are similar to a region conserved amongst various protein products of the transmembrane channel-like (TMC) gene family, such as Transmembrane channel-like protein 3 (Q7TN63) and EVIN2 (Q8IU68) - this region is termed the TMC domain [(PUBMED:12906855)]. Mutations in these genes are implicated in a number of human conditions, such as deafness and epidermodysplasia verruciformis [(PUBMED:12906855)]. TMC proteins are thought to have important cellular roles, and may be modifiers of ion channels or transporters [(PUBMED:12812529)].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMC