The domain within your query sequence starts at position 1 and ends at position 121; the E-value for the TMCO5 domain shown below is 3.6e-14.

MMSLQLGTAGKERQLAEKSRDLQNVSMTEGSEEVSEMDHISDRPDEKDKPSENLQTDSLY
KMDTEKWDGLEQESEHSQDPPSKPDEQEVTLVCEGPQVSQLSPSTDESTPIPESLTHKLN
Y

TMCO5

TMCO5
PFAM accession number:PF14992
Interpro abstract (IPR026617): Proteins in this family are single-pass membrane proteins. Their function is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMCO5