The domain within your query sequence starts at position 142 and ends at position 346; the E-value for the TMCO5 domain shown below is 2.5e-48.

ERINNIIQNINNTESTVKSLLTEVISLENQSKNLEDSDQEADIEEKITEIRRQLKEVNIK
LTQVDACEEARELKEKLVEQIESFHKEMNVLNSKLEMYYTQGSDADSHNSEDVDTEQEEP
LVPEASPSLSASPTPPCSAVWKNALKLFVIVYVVTITGLSCYILFVDATFLFERVLPSVL
GHRTMWDLREMMAPFLNLEAEDLLP

TMCO5

TMCO5
PFAM accession number:PF14992
Interpro abstract (IPR026617): Proteins in this family are single-pass membrane proteins. Their function is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMCO5