The domain within your query sequence starts at position 14 and ends at position 72; the E-value for the TMEM125 domain shown below is 2e-31.

DVLAEQVELWWSQQPRRSLLCFSVAVILVAGCGAGGVALLSSTSSRSGEWRLAVGTVLC

TMEM125

TMEM125
PFAM accession number:PF15109
Interpro abstract (IPR028165):

This is a family of uncharacterised transmembrane proteins found in eukaryotes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM125