The domain within your query sequence starts at position 91 and ends at position 174; the E-value for the TMEM131_like domain shown below is 5.8e-20.
LHFQPSVLDFGIQFLGHPAAKLLYAYNPSRESEVVVNSVFTAARHFHVPPVHCRVIPAMG KASFRVIFLPTEEGSIESSLFINT
TMEM131_like |
---|
PFAM accession number: | PF12371 |
---|---|
Interpro abstract (IPR022113): | This domain can be found in bacterial, plant and other metazoa transmembrane proteins. Many of the members are multi-pass transmembrane proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM131_like