The domain within your query sequence starts at position 432 and ends at position 774; the E-value for the TMEM132 domain shown below is 5.9e-145.

EILNTAILTGKPVSVPVKVVGVQEDGSVVDVLESVECRSADEDVVKVSNTCDSIFVNGKE
MKSKVGTIVNFTHQHFTSQVEITVWVPRLPLQIEISDTELSQIKGWRIPVASNRRPTRES
DDEEDEEKKGRGCTLQYQHALVRVLTQFVSESPDLGQLTYMLGPDWQFDITNLVTEFVKV
EEPKIAQLQNGRILAGREPGITTVQVLSPLSDSILAEKTVIVLDDRVTITELGVQLVAGL
SLSLQPHRADKRAIVSTVAAQDVLQAPQQEAIVSSWILFSDGAVTPLDIYDLKDFSVTVS
SLDEMVVSVQPNLQTRWPIVVAEGEGQGPLIKLEMSISESCQK

TMEM132

TMEM132
PFAM accession number:PF16070
Interpro abstract (IPR031437):

This presumed domain is found in members of the TMEM132 family. TMEM132A may be involved in embryonic and postnatal brain development [(PUBMED:12514190)]. TMEM132D may be a marker for oligodendrocyte differentiation [(PUBMED:12966072)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM132