The domain within your query sequence starts at position 2 and ends at position 97; the E-value for the TMEM141 domain shown below is 1e-43.
VNLGLSRVDDAVAARHPGLEEFAACQSHAFMKGVFTFVTGTGATFGLLMFIKRKFPYPVQ WSFLVSAIAGSVASYRVTSMECQKCSNLWLFLETGQ
TMEM141 |
 |
|---|
| PFAM accession number: | PF15110 |
|---|---|
| Interpro abstract (IPR026788): | Proteins in this family are multi-pass membrane proteins. Their function is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM141