The domain within your query sequence starts at position 24 and ends at position 163; the E-value for the TMEM154 domain shown below is 6.2e-52.
DEESEYSGQSITEEENSEDETTRSALATVTTEALAENVNSTHTNDTSNQVEFILMVAIPL AALLILLFMVLIATYFKSKRPKQEPSSQGSQSALQTHELGGETLKVPIFEEDTPSVMEIE MEELDKWMNSMNRNADYECL
TMEM154 |
---|
PFAM accession number: | PF15102 |
---|---|
Interpro abstract (IPR028064): | The function of this family of transmembrane proteins has not, as yet, been determined. However, it is thought to be a therapeutic target for ovine lentivirus infection [ (PUBMED:22291605) ]. This family of proteins is found in eukaryotes and members are typically between 138 and 320 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM154