The domain within your query sequence starts at position 147 and ends at position 277; the E-value for the TMEM169 domain shown below is 6.1e-66.
RRACQVGADQGPHVVLWTLVCLPVVFVLSFVVSFYYGTITWYNIFLVYNEERTFWHKISC CPCLILFYPVLIMTMASSLGLYAAVAQLSWSWAAWWRAACDMEKGFCGWLCSKLGLEDCS PYSIVELLESD
TMEM169 |
![]() |
---|
PFAM accession number: | PF15052 |
---|---|
Interpro abstract (IPR029386): | This entry represents a group of eukaryotic proteins that are approximately 130 amino acids in length. They contain structured transmembrane helices. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM169