The domain within your query sequence starts at position 2 and ends at position 109; the E-value for the TMEM171 domain shown below is 1e-57.
SSVGTAEPDGDQRDRHVSKLIFFLFVFGAALLCVGVLLSIFGYQACQYKPLSHCSIVLKI AGPSCAVVGLGAVILARSRARLHLRERQRQGLQDPDQSFFCGESRQFA
TMEM171 |
![]() |
---|
PFAM accession number: | PF15471 |
---|---|
Interpro abstract (IPR029173): | This entry represents a group of eukaryotic proteins, TMEM71 (also known as parturition-related protein 2). They are typically between 242 and 326 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM171