The domain within your query sequence starts at position 44 and ends at position 336; the E-value for the TMEM173 domain shown below is 4.7e-125.

LKYLALHLASHELGLLLKNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSS
YFYFLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYY
IGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDM
LPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDR
LEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEE

TMEM173

TMEM173
PFAM accession number:PF15009
Interpro abstract (IPR029158):

Transmembrane protein 173, also known as stimulator of interferon genes protein (STING) or endoplasmic reticulum interferon stimulator (ERIS), is a transmembrane adaptor protein which is involved in innate immune signalling processes. It induces expression of type I interferons (IFN-alpha and IFN-beta) via the NF-kappa-B and IRF3, pathways in response to non-self cytosolic RNA and dsDNA [(PUBMED:18724357), (PUBMED:19776740), (PUBMED:18818105), (PUBMED:19433799)].

GO process:activation of innate immune response (GO:0002218), positive regulation of type I interferon production (GO:0032481)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM173