The domain within your query sequence starts at position 14 and ends at position 133; the E-value for the TMEM18 domain shown below is 5.7e-49.
IPAVIMETDWTEPWLLGLLAFHLLCLLLTCFSSQRYKLQIGHFLCLVVLVYSAEYINEVA AVNWRLFSKYQYFDSRGMFISLVFSAPLLFNAMLIVIMWVRKTLTVMTDLKTLQEERKER
TMEM18 |
 |
|---|
| PFAM accession number: | PF14770 |
|---|---|
| Interpro abstract (IPR026721): | This entry represent the transmembrane protein 18 (TMEM18). In humans, TMEM18 is a transcription repressor and a sequence-specific ssDNA and dsDNA binding protein, with preference for GCT end CTG repeats [ (PUBMED:21980424) ]. It enhances the tropism of neural stem cells for glioma cells [ (PUBMED:18559506) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM18