The domain within your query sequence starts at position 21 and ends at position 147; the E-value for the TMEM190 domain shown below is 3.3e-70.

ANGIQGFFYPWSCEGDVWDRESCGGQAAIENPNLCLRLRCCYRDGVCYHQRPDENMRRKH
MWALGWTCGSLLFLITSICLFWWARRQDMLHLPRFLHRKCSKLSKTVSSLSKDRRSANKS
TTVLQSP

TMEM190

TMEM190
PFAM accession number:PF15431
Interpro abstract (IPR028248): This entry represents the transmembrane protein 190 (TMEM190) family. In mice, this protein may play an indirect role in sperm-oocyte fusion [(PUBMED:21273369)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM190