The domain within your query sequence starts at position 21 and ends at position 147; the E-value for the TMEM190 domain shown below is 3.3e-70.
ANGIQGFFYPWSCEGDVWDRESCGGQAAIENPNLCLRLRCCYRDGVCYHQRPDENMRRKH MWALGWTCGSLLFLITSICLFWWARRQDMLHLPRFLHRKCSKLSKTVSSLSKDRRSANKS TTVLQSP
TMEM190 |
---|
PFAM accession number: | PF15431 |
---|---|
Interpro abstract (IPR028248): | This entry represents the transmembrane protein 190 (TMEM190) family. In mice, this protein may play an indirect role in sperm-oocyte fusion [ (PUBMED:21273369) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM190