The domain within your query sequence starts at position 1 and ends at position 59; the E-value for the TMEM191C domain shown below is 1.2e-29.

MEAAAALEATRGGSEPWNSEPRPVQDCAGSLMEEVARADCEKRLFGGTGAGSLRNSPQG

TMEM191C

 TMEM191C
PFAM accession number:PF15194
Interpro abstract (IPR028186):

Proteins in this family are uncharacterised single-pass membrane proteins found in eukaryotes. Proteins in this family are typically between and 302 amino acids in length. There are two conserved sequence motifs: QDC and RLF. The function of this family is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM191C