The domain within your query sequence starts at position 146 and ends at position 215; the E-value for the TMEM192 domain shown below is 1.4e-27.

SVKIRRFNRAKPLPDVLEEEKIYAYPSNTASETGFRTVSSLEEIVEKQEDIIVYLKRHNA
LLSKRLLELA

TMEM192

 TMEM192
PFAM accession number:PF14802
Interpro abstract (IPR029399):

The function of this family of transmembrane proteins is unknown. In vertebrates, proteins in this family are located in the lysosomal membrane and late endosome [ (PUBMED:20370317) (PUBMED:21143193) ]. In Arabidopsis, a member of this family (protein FIP1) has been found to weakly interact with FRIGIDA, a determinant of flowering time [ (PUBMED:19429606) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM192