The domain within your query sequence starts at position 25 and ends at position 148; the E-value for the TMEM192 domain shown below is 7e-35.
DTQPLPHHSLQAQFRPRFHPLPTVIIANLLLLIHVVFVVLAFLTGVPCLYPNPTEDKCPE NYTSPLKVQTAIILGKLILWILHLLFERYVQYHHRKVRSRGYSQIYRSTRHLKTLALTIH SSVK
TMEM192 |
---|
PFAM accession number: | PF14802 |
---|---|
Interpro abstract (IPR029399): | The function of this family of transmembrane proteins is unknown. In vertebrates, proteins in this family are located in the lysosomal membrane and late endosome [ (PUBMED:20370317) (PUBMED:21143193) ]. In Arabidopsis, a member of this family (protein FIP1) has been found to weakly interact with FRIGIDA, a determinant of flowering time [ (PUBMED:19429606) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM192