The domain within your query sequence starts at position 10 and ends at position 105; the E-value for the TMEM219 domain shown below is 1e-31.
LKLYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEMAEDWNTFLLRFNDLDLCV SENETLKHLSNDTTTPESTMTVGQARSSTQPPQSLE
TMEM219 |
---|
PFAM accession number: | PF14940 |
---|---|
Interpro abstract (IPR039587): | Proteins containing this domain include TMEM248 and TMEM219 (also known as insulin-like growth factor-binding protein 3 receptor, IGFBP-3R) from animals. TMEM219 is a cell death receptor and is essential for the IGFBP-3-induced apoptosis and tumor suppression [ (PUBMED:20353938) ]. The function of TMEM248 is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM219