The domain within your query sequence starts at position 11 and ends at position 126; the E-value for the TMEM234 domain shown below is 2.1e-46.
LVLVAALWGGTQPLLKRASSGLEQVRERTWAWQLLQEIKALFGNTEYLMPFLLNQSGSLL YYLTLASTDLTLAVPICNSLAIVFTLIVGKVLGEDIGGKEAVAGMVLTITGITVCI
TMEM234 |
---|
PFAM accession number: | PF10639 |
---|---|
Interpro abstract (IPR018908): | TMEM234 is a family of putative inner membrane proteins. Many bacterial members are annotated as putative L-Ara4N-phosphoundecaprenol flippase subunit ArnE, and as inner membrane proteins. They may be transporters of the multi-drug-resistant superfamily. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM234