The domain within your query sequence starts at position 129 and ends at position 230; the E-value for the TMEM237 domain shown below is 9e-28.

PAEPQYASELGVEDEDILTDEQSTLEHHSRFTAPTGVSQPVGKVFVEKSRRFQAADRSEL
IKTTENIDVSMDVKPSWTTRDVALSVHRAFRMVGLFSHGFLA

TMEM237

TMEM237
PFAM accession number:PF15383
Interpro abstract (IPR029409):

This entry represents a group of eukaryotic proteins that aid the production of new cilia in ciliogenesis. Mutations in the human protein cause a disease named Joubert syndrome type 14 (JBTS14), which is an autosomal recessive disorder characterised by severe mental retardation, hypotonia, breathing abnormalities in infancy, and dysmorphic facial features [(PUBMED:22152675)]. Loss of the mammalian TMEM237 results in defective ciliogenesis and deregulation of Wnt signaling [(PUBMED:22152675)]. Proteins in this family are typically between 203 and 512 amino acids in length. There are two completely conserved G residues that may be functionally important.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM237