The domain within your query sequence starts at position 1 and ends at position 149; the E-value for the TMEM239 domain shown below is 1.2e-85.
MQQPRVESDIIGAGEGPQRAVPWSAWIIRQDWVRWWVCHIPRSWTQWWNTSGWRQPLQRM LWGLEGTLYLLLALMLCHALFTTGSYLLSSLWPVVAVMWSHLLPAILLLVLSALPALLFA ASFLLLFSTLLSLVGLLTSMTQPGYAQDL
TMEM239 |
---|
PFAM accession number: | PF15841 |
---|---|
Interpro abstract (IPR031694): | This family of proteins is found in mammals. Proteins in this family are typically between 152 and 198 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM239