The domain within your query sequence starts at position 1 and ends at position 210; the E-value for the TMEM247 domain shown below is 2e-115.
MAMEDREVMEARGAGESCPTLSKVAPVDSMPEGKPKASLDAEVPKLELPTLEENGICEDR DCPGPPRSLPPKSGPNAKGQAGDGPGLESVELPLPLETEHRNAMELEKVRMEFELTLLKY LHQENERQRQHEEVMEQLQQQQQQQQALPHQFSGSLQDLLLPQNQFAMFFYCFIFIHIIY VAKETVFFLFSKHYLFCLAAILLCLIKTLW
TMEM247 |
---|
PFAM accession number: | PF15444 |
---|---|
Interpro abstract (IPR029200): | This family of transmembrane proteins is found in eukaryotes. Proteins in this family are typically between 197 and 222 amino acids in length. The function of this family is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM247