The domain within your query sequence starts at position 146 and ends at position 265; the E-value for the TMEM40 domain shown below is 2.4e-74.

ELQLCGGAAGEMVPTGESGLRRRGSGSAEGEVEASQLRRLNIKKDDEFFHFVLLCFAIGA
LLVCYHYYADWFMSLGVGLLTFASLETIGIYFGLVYRIHSVLQGFIPLLQKFRLPGFRRT

TMEM40

TMEM40
PFAM accession number:PF15817
Interpro abstract (IPR026181): This entry the transmembrane protein 40 family, members of which are multi-pass membrane proteins whose function is currently unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM40