The domain within your query sequence starts at position 104 and ends at position 235; the E-value for the TMEM70 domain shown below is 2.4e-58.
VKCFSYSTSVVSLAFLPYLLSQNNMMFGSLPLQVLFYGVMGSFTVITPTLLHLLTKGYVI RLYHEATSDTYRAVTYNVMLSETSTVFHQDDVTIPESAHIFTSFYAKTKSLLVNPALFLN PEDYNHLMGYDK
TMEM70 |
---|
PFAM accession number: | PF06979 |
---|---|
Interpro abstract (IPR009724): | TMEM70 is a family of proteins essential for assembly of the mitochondrial proton-transporting ATP synthase complex within the inner mitochondrial membrane [ (PUBMED:18953340) (PUBMED:20937241) (PUBMED:22986587) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM70