The domain within your query sequence starts at position 17 and ends at position 168; the E-value for the TMEM95 domain shown below is 3.9e-83.

CIFCRLQDHALANRLAQLNNQTKPKWKWKEWASPDFSAFALDEVSMKQVTEKTHRVLRVI
EKKGSTSLIPLYWQWLQKTRIPQYTREALCAPVCRGSTILYNCSTCEGKEESCWPQKHCY
PDSHDLWDARILLLCIFGIVLLSGVVSLQVEY

TMEM95

 TMEM95
PFAM accession number:PF15203
Interpro abstract (IPR027984):

TMEM95 and its homologues can be found in eukaryotes. They have a conserved LGG sequence motif. TMEM95 is a sperm membrane protein required for sperm-oocyte fusion and is essential for mammalian fertilization [ (PUBMED:32393636) (PUBMED:32484434) ].

GO process:fusion of sperm to egg plasma membrane involved in single fertilization (GO:0007342)
GO component:sperm plasma membrane (GO:0097524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMEM95