The domain within your query sequence starts at position 972 and ends at position 1085; the E-value for the TMF_TATA_bd domain shown below is 1.5e-35.

YEAVRMGAGSSIIENLQSQLKLREGEISHLQLEISNLEKTRSIMSEELVKLTNQNDELEE
KVKEIPKLRVQLRDLDQRYNTILQMYGEKAEEAEELRLDLEDVKNMYKTQIDEL

TMF_TATA_bd

TMF_TATA_bd
PFAM accession number:PF12325
Interpro abstract (IPR022091):

This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [ (PUBMED:1409643) ]. The proteins bind to the TATA element of some RNA polymerase II promoters and repress their activity. by competing with the binding of TATA binding protein. TMF1_TATA_bd is the most conserved part of the TMFs [ (PUBMED:15128430) ]. TMFs are evolutionarily conserved golgins that bind Rab6, a ubiquitous ras-like GTP-binding Golgi protein, and contribute to Golgi organisation in animal [ (PUBMED:18182439) ] and plant cells. The Rab6-binding domain appears to be the same region as this C-terminal family [ (PUBMED:18182439) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMF_TATA_bd