The domain within your query sequence starts at position 12 and ends at position 93; the E-value for the TMPIT domain shown below is 9e-23.
CLRNWEDLQQDFQGIQKKRLQELALVLKKCRPSLPSESMEAAQELENQMKERQGLFFDME AYLPKKNGLYLSLVLGNVNVT
TMPIT |
---|
PFAM accession number: | PF07851 |
---|---|
Interpro abstract (IPR012926): | This entry represents a group of transmembrane proteins including TACAN (also known as TMEM120A) and TMEM120B. TACAN is an ion channel that contributes to sensing mechanical pain [ (PUBMED:32084332) ]. TACAN and TMEM120B may be required for efficient adipogenesis [ (PUBMED:26024229) ]. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMPIT