The domain within your query sequence starts at position 12 and ends at position 93; the E-value for the TMPIT domain shown below is 9e-23.

CLRNWEDLQQDFQGIQKKRLQELALVLKKCRPSLPSESMEAAQELENQMKERQGLFFDME
AYLPKKNGLYLSLVLGNVNVT

TMPIT

TMPIT
PFAM accession number:PF07851
Interpro abstract (IPR012926):

This entry represents a group of transmembrane proteins including TACAN (also known as TMEM120A) and TMEM120B. TACAN is an ion channel that contributes to sensing mechanical pain [ (PUBMED:32084332) ]. TACAN and TMEM120B may be required for efficient adipogenesis [ (PUBMED:26024229) ].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TMPIT