The domain within your query sequence starts at position 1468 and ends at position 1646; the E-value for the TNRC6-PABC_bdg domain shown below is 4.1e-75.

SPNTFAPYPLAGLNPNMNVNSIDMSSGLSVKDPSQSQSRLPQWTHPNSMGNLSSAASPLD
QNPSKHGAIPGGLSIGPPGKSSIDDSYGRYDLIQNSESPASPPVAVPHSWSRAKSDSDKI
SNGSSISWPPEFHPGVPWKGLQNIDPENDPDVTPGSVPTGPTINTTIQDVNRYLLKSGG

TNRC6-PABC_bdg

TNRC6-PABC_bdg
PFAM accession number:PF16608
Interpro abstract (IPR032226):

This entry represents a natively unstructured region found in TNRC6 protein that carries the binding motif for the interaction with PABC (polyadenylate-binding protein 1). TNRC6 are trinucleotide repeat-containing gene 6 proteins required for miRNA-mediated gene silencing that are localised to the P bodies (processing bodies). P bodies are cytoplasmic mRNP aggregates that are involved in general mRNA translation repression and decay, including nonsense-mediated decay. The interaction motif that binds to PABC is SINWPPEFHPGVPWKGLQ [(PUBMED:20098421)]. This region lies between a Q-rich region and the RRM, or RNA-recognition motif.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TNRC6-PABC_bdg