The domain within your query sequence starts at position 1 and ends at position 74; the E-value for the TOM6p domain shown below is 5.2e-49.

MASSGVTVSAAGSASEASEVPDNVGDWLRGVFRFATDRNDFRRNLILNLGLFAAGVWLAR
NLSDIDLMAPQPGV

TOM6p

TOM6p
PFAM accession number:PF15184
Interpro abstract (IPR029182):

In budding yeasts, Tom6 forms part of the pre-protein translocase complex of the outer mitochondrial membrane (TOM complex) [(PUBMED:18331822)]. This family is found in metazoans. Proteins in this family are homologues of the yeast Tom6, and are typically between 43 and 74 amino acids in length.

GO component:mitochondrial outer membrane translocase complex (GO:0005742)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TOM6p