The domain within your query sequence starts at position 1 and ends at position 47; the E-value for the TOM_sub5 domain shown below is 9.3e-31.

MFRIEGLAPKLDPEEMKRKMREDVVSSIRNFLIYVALLRVKPGMVAH

TOM_sub5

TOM_sub5
PFAM accession number:PF15178
Interpro abstract (IPR029179):

In budding yeasts, Tom5 forms part of the pre-protein translocase complex of the outer mitochondrial membrane (TOM complex) [(PUBMED:18331822)]. This family is found in metazoans. Proteins in this family are homologues of yeast Tom5 and are approximately 50 amino acids in length.

GO component:mitochondrial outer membrane translocase complex (GO:0005742)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TOM_sub5