The domain within your query sequence starts at position 614 and ends at position 691; the E-value for the TORC_C domain shown below is 4.3e-31.

PNIILTGDSSPGFSKEIAAALAGVPGFEVSASGLELGLGLEDELRMEPLGLEGLTMLSDP
CALLPDPAVEDSFRSDRL

TORC_C

TORC_C
PFAM accession number:PF12886
Interpro abstract (IPR024785):

This entry represents the C-terminal domain of TORC proteins. TORC (transducer of regulated CREB activity) is a protein family of coactivators that enhances the activity of CRE-dependent transcription via a phosphorylation-independent interaction with the bZIP DNA binding/dimerisation domain of CREB (cAMP Response Element-Binding) [(PUBMED:14536081)]. The C-terminal domain is negatively charged, resembling transcription activation domains, and experimental studies indicate that it may play a role in activation of transcription [(PUBMED:14506290)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TORC_C