The domain within your query sequence starts at position 6 and ends at position 66; the E-value for the TORC_N domain shown below is 1.1e-26.

NPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSL
P

TORC_N

TORC_N
PFAM accession number:PF12884
Interpro abstract (IPR024783):

This entry represents the N-terminal domain of TORC proteins. TORC (transducer of regulated CREB activity) is a protein family of coactivators that enhances the activity of CRE-dependent transcription via a phosphorylation-independent interaction with the bZIP DNA binding/dimerisation domain of CREB (cAMP Response Element-Binding) [(PUBMED:14536081)]. The proteins display a highly conserved predicted N-terminal coiled-coil domain and an invariant sequence matching a protein kinase A (PKA) phosphorylation consensus sequence (RKXS) [(PUBMED:14506290)]. The coiled-coil structure interacts with the bZIP domain of CREB [(PUBMED:14536081)]. This interaction may occur via ionic bonds because it is disrupted under high-salt conditions [(PUBMED:17565599)]. In addition to CREB-binding, the N-terminal domain plays a role in the tetramer formation of TORCs [(PUBMED:14536081)], but the physiological function of the multimeric complex has not been clarified yet.

GO process:protein homotetramerization (GO:0051289)
GO function:cAMP response element binding protein binding (GO:0008140)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TORC_N