The domain within your query sequence starts at position 28 and ends at position 238; the E-value for the TP53IP5 domain shown below is 2e-97.
QHVSKVIERNRLKMVLKNLSLLKLFKSSNSRIQELHKLARRCWNSMLRVPKILQISSRDK DKVKQNNIKFQEIRVLEMRPNSKKAESVKEPKQKTSKKWKPKQGSKGSPAAVTWRKKQET FKISKVIKSGGLQARAQKRKTYVKKPRVVFLKTYHHSTTMGKMKALDITDQLVWFEGLPT RIHIPGRRIMCRSSTYRCLKRSCTRFCCASL
TP53IP5 |
---|
PFAM accession number: | PF15331 |
---|---|
Interpro abstract (IPR029290): | The tumour suppressor TP53 gene (encoding cellular tumour antigen p53 or p53) is the most frequently altered gene in human tumours. TP53-target gene 5 protein (also known as cellular tumour antigen p53-inducible 5) suppresses cell growth and may play a significant role in p53/TP53-mediating signalling pathway. Its intracellular location and expression change in a cell-cycle-dependent manner [ (PUBMED:10719363) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TP53IP5