The domain within your query sequence starts at position 107 and ends at position 170; the E-value for the TP6A_N domain shown below is 3e-28.
SVKKFALILKVLSMIYKLIQSDTYATKRDIYYTDSQLFGNQAAVDSAIDDISCMLKVPRR SLHV
TP6A_N |
 |
|---|
| PFAM accession number: | PF04406 |
|---|---|
| Interpro abstract (IPR013049): | This entry represents the N-terminal domain found in Spo11, a meiotic recombination protein found in eukaryotes, and in subunit A of topoisomerase VI, a type IIB topoisomerase found predominantly in archaea [ (PUBMED:10545127) (PUBMED:12618182) ]. These two types of proteins share structural homology. |
| GO process: | DNA metabolic process (GO:0006259) |
| GO component: | chromosome (GO:0005694) |
| GO function: | ATP binding (GO:0005524), catalytic activity (GO:0003824), DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TP6A_N