The domain within your query sequence starts at position 66 and ends at position 133; the E-value for the TP6A_N domain shown below is 3.8e-26.

SPKSVKKFALILKVLSMIYKLIQSDTYATKRDIYYTDSQLFGNQAAVDSAIDDISCMLKV
PRRSLHVL

TP6A_N

TP6A_N
PFAM accession number:PF04406
Interpro abstract (IPR013049):

This entry represents the N-terminal domain found in Spo11, a meiotic recombination protein found in eukaryotes, and in subunit A of topoisomerase VI, a type IIB topoisomerase found predominantly in archaea [(PUBMED:10545127), (PUBMED:12618182)]. These two types of proteins share structural homology.

GO process:DNA metabolic process (GO:0006259)
GO component:chromosome (GO:0005694)
GO function:DNA binding (GO:0003677), ATP binding (GO:0005524), catalytic activity (GO:0003824)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TP6A_N