The domain within your query sequence starts at position 132 and ends at position 275; the E-value for the TPD domain shown below is 2.2e-53.
PDGVLANQVYQCIVNDCCYGPLVDCIKHAIGYEHEVLLRDLLLKKNLSFLDEDQLRAKGY DKTPDFILQVPVVMLCPLAVEGHIIHWIESKASFGDECSHHAYLHGQFWSYWNRFGPGLV IYWYGFIQELDCNRERGILLKASF
TPD |
---|
PFAM accession number: | PF14811 |
---|---|
Interpro abstract (IPR029404): | This is a family of proteins includes CDIN1 from human, and homologues. CDIN1 is thought to play a role in erythroid cell differentiation [ (PUBMED:31191338) ]. Some family members have an associated zinc-finger domain. All members carry a highly conserved TPD sequence-motif. |
GO process: | erythrocyte differentiation (GO:0030218) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPD