The domain within your query sequence starts at position 132 and ends at position 275; the E-value for the TPD domain shown below is 2.2e-53.

PDGVLANQVYQCIVNDCCYGPLVDCIKHAIGYEHEVLLRDLLLKKNLSFLDEDQLRAKGY
DKTPDFILQVPVVMLCPLAVEGHIIHWIESKASFGDECSHHAYLHGQFWSYWNRFGPGLV
IYWYGFIQELDCNRERGILLKASF

TPD

TPD
PFAM accession number:PF14811
Interpro abstract (IPR029404):

This is a family of proteins of unknown function. A few members have an associated zinc-finger domain. All members carry a highly conserved TPD sequence-motif.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPD