The domain within your query sequence starts at position 9 and ends at position 187; the E-value for the TPD52 domain shown below is 1.3e-74.

LETEPLQGRDGDAVGSADFSSMLSEEEKEELKAELIQLEDEITTLRQVLSAKERHLVEIK
QKLGMNLMNELKQNFSRSWHDMQTTTAYKKTHETLSHAGQKATAAFNNVGTAISKKFGDM
RYSIRHSISMPAMRNSSTFKSFEERVETTVASLKTKVGGTNHGGGSFEEVLNSTAHASS

TPD52

TPD52
PFAM accession number:PF04201
Interpro abstract (IPR007327): The hD52 gene was originally identified through its elevated expression level in human breast carcinoma. Cloning of D52 homologues from other species has indicated that D52 may play roles in calcium-mediated signal transduction and cell proliferation. Two human homologues of hD52, hD53 and hD54, have also been identified, demonstrating the existence of a novel gene/protein family [(PUBMED:9484778)]. These proteins have an N-terminal coiled-coil that allows members to form homo- and heterodimers with each other [(PUBMED:9484778)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPD52