The domain within your query sequence starts at position 142 and ends at position 475; the E-value for the TPH domain shown below is 8.9e-22.

QTERVKRFHSGLLLSRVMKERDVQIQYKKNAVKSDKKWEEQVKLNDEKAFKEDQEKEEKR
RRERVALAEDHLKQIEEHKEEEEARKKSEEKDAEEMKRQNLLYEIEMKKNLSKKQEEIDT
NRKLLLDNMHNKNIIRAVEQQQQEEEDEKIRKFIKAKKRLIQMRMDKDAETHRLMEERRE
RINNFLSKLIKEKLDTEDLIIARDISEADAELEKREKEKHEKNQADLKAIAEYRASVMKN
KEEEERQRKIEAKEQLQAVLKADKIFQELEKEKSLKVTREKLEIQDAHIQQIAINKYNAK
QMKEEELDYWRLTDALTVEKEKEFEKYAREVINF

TPH

TPH
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPH