The domain within your query sequence starts at position 187 and ends at position 532; the E-value for the TPH domain shown below is 1.5e-85.

QEEELKDMSKIILNAKCHAIRDAQILEKQQIQKELDEEERRLDHMMEIDRRESLQRQEDR
ERKRREERVRGKRHIVEQIKKNEEERSLQAEHREQEKEQMLAYLDRLQEEDLQDLERRHQ
EKLKMQAEIKRINDENQRQKAEMLAQERLADQMVMEFTKKKMAREAEYEAEQEKIRREKE
KEIARLRALQEKAQDYQAEQDALRAKRNQEVADREWRRKEKENAQKKIETEEKLRKSRLE
QVAFKEHTLAVQVQRDRDEFERILRAQREQIEREKQEQEKKAKGCLQHANELRRQVRENQ
QKHVQNRLATFEEGRRLKEEAEKRRERIEDIKKQKLEELRATGLPE

TPH

TPH
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPH