The domain within your query sequence starts at position 30 and ends at position 155; the E-value for the TPK_catalytic domain shown below is 2.4e-44.
ARFRHLWKKALLRACADGGANHLYDLTEGERESFLPEFVSGDFDSIRPEVKEYYTKKGCD LISTPDQDHTDFTKCLQVLQRKIEEKELQVDVIVTLGGLGGRFDQIMASVNTLFQATHIT PVPIII
TPK_catalytic |
![]() |
---|
PFAM accession number: | PF04263 |
---|---|
Interpro abstract (IPR007371): | Thiamin pyrophosphokinase (TPK, EC 2.7.6.2 ) catalyzes the transfer of a pyrophosphate group from ATP to vitamin B1 (thiamin) to form the coenzyme thiamin pyrophosphate (TPP). Thus, TPK is important for the formation of a coenzyme required for central metabolic functions. The structure of thiamin pyrophosphokinase suggests that the enzyme may operate by a mechanism of pyrophosphoryl transfer similar to those described for pyrophosphokinases functioning in nucleotide biosynthesis [ (PUBMED:11435118) ]. |
GO process: | thiamine diphosphate biosynthetic process (GO:0009229) |
GO function: | thiamine diphosphokinase activity (GO:0004788), ATP binding (GO:0005524) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPK_catalytic