The domain within your query sequence starts at position 773 and ends at position 966; the E-value for the TPPII domain shown below is 2.7e-93.

FDVQSSLKYEDLAPCITLKSWVQTLRPVNAKTRPLGSRDVLPNNRQLYEMVLTYSFHQPK
SGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQYSLKLEKGDYTIRLQI
RHEQISDLDRLKDLPFIVSHRLSNTLSLDIHENHSLALLGKKKSSSLTLPPKYNQPFFVT
SLPDDKIPKGAGPG

TPPII

TPPII
PFAM accession number:PF12580
Interpro abstract (IPR022229):

This entry represents a region of approximately 190 amino acids in length and is found in association with. The members are serine peptidases belonging to MEROPS peptidase family S8A, tripeptidyl peptidase II (TPPII), clan SB. They are a crucial component of the proteolytic cascade acting downstream of the 26S proteasome in the ubiquitin-proteasome pathway. It is an amino peptidase belonging to the subtilase family removing tripeptides from the free N terminus of oligopeptides.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPPII