The domain within your query sequence starts at position 179 and ends at position 310; the E-value for the TPP_enzyme_M domain shown below is 1.5e-34.

VCAAASVLRDAKQPLLIIGKGAAYSHAEDSIRKLVEQCSLPFLPTPMGKGVVPDNHPNCV
GAARSRALQSADVIVLFGARLNWILHFGLPPRYQADVKFIQIDICAEELGNNVRPSVILL
GDIDAVSKQLLE

TPP_enzyme_M

TPP_enzyme_M
PFAM accession number:PF00205
Interpro abstract (IPR012000):

A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor. It has been shown [(PUBMED:8604141)] that some of these enzymes are structurally related. This central domain of TPP enzymes contains a 2-fold Rossman fold.

GO function:thiamine pyrophosphate binding (GO:0030976), magnesium ion binding (GO:0000287)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPP_enzyme_M