The domain within your query sequence starts at position 180 and ends at position 311; the E-value for the TPP_enzyme_M domain shown below is 4.7e-34.
VCAAASVLRDAKQPLLIIGKGAAYSHAEDSIRKLVEQCSLPFLPTPMGKGVVPDNHPNCV GAARSRALQSADVIVLFGARLNWILHFGLPPRYQADVKFIQIDICAEELGNNVRPSVILL GDIDAVSKQELA
TPP_enzyme_M |
---|
PFAM accession number: | PF00205 |
---|---|
Interpro abstract (IPR012000): | A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor. It has been shown [ (PUBMED:8604141) ] that some of these enzymes are structurally related. This central domain of TPP enzymes contains a 2-fold Rossman fold. |
GO function: | thiamine pyrophosphate binding (GO:0030976), magnesium ion binding (GO:0000287) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPP_enzyme_M