The domain within your query sequence starts at position 1112 and ends at position 1240; the E-value for the TPR_MLP1_2 domain shown below is 5.1e-37.

KTLSTVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQ
AAKEQVSKMTSIRQHLEETTQKAESQLLECKASWEERERVLKDEVSKSVSRCEDLEKQNR
LLHDQIEKL

TPR_MLP1_2

TPR_MLP1_2
PFAM accession number:PF07926
Interpro abstract (IPR012929):

This domain is found in a number of proteins, including TPR protein (P12270) and yeast myosin-like protein 1 (MLP1, Q02455). These proteins share a number of features; for example, they have coiled-coil regions and are associated with nuclear pores [(PUBMED:9024684), (PUBMED:7798308), (PUBMED:10085285)]. TPR is thought to be a component of nuclear pore complex- attached intranuclear filaments [(PUBMED:9024684)], and is implicated in nuclear protein import [(PUBMED:7798308)]. Moreover, its N-terminal region is involved in the activation of oncogenic kinases, possibly by mediating the dimerisation of kinase domains or by targeting these kinases to the nuclear pore complex [(PUBMED:7798308)]. Mlp1 acts as a docking platform for for heterogeneous nuclear ribonucleoproteins that are required for mRNA export [(PUBMED:12531921)].

GO process:protein import into nucleus (GO:0006606)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPR_MLP1_2