The domain within your query sequence starts at position 144 and ends at position 199; the E-value for the TPT domain shown below is 1.2e-11.

GFALVLGASFIGGIRWTLTQILLQKADLGLQNPIDTMFHLQPLMFLGLFPLFAIFE

TPT

TPT
PFAM accession number:PF03151
Interpro abstract (IPR004853):

This domain is found in a number of sugar phosphate transporters, including those with a specificity for triose phosphate [ (PUBMED:11432728) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TPT